- Septin-7 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-85731
- CDC10, CDC3, NBLA02942, SEPT7, SEPT7A
- Human, Mouse, Rat
- 0.1 ml (also 25ul)
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- PBS (pH 7.2) and 40% Glycerol
- This antibody was developed against Recombinant Protein corresponding to amino acids: VNIIPLIAKA DTLTPEECQQ FKKQIMKEIQ EHKIKIYEFP ETDDEEENKL VKKIKDRLPL AVVGSNTIIE VNGKRVRGRQ YPW
- Septin-7
- Unconjugated
- Rabbit
- septin 7
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
VNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPW
Specifications/Features
Available conjugates: Unconjugated